PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 574aa    MW: 64245.3 Da    PI: 4.7572
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766066.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.34.9e-1372065743374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + L++cA a+++g+ e+a++++++l++++s +g+p++R aay++eALaar+a s+++lykal+++e+     se+l+a+++++ev+P+++f++++
  XP_009766066.1 206 QMLFSCAAAIQDGNIEQASSMINELRQMVSIQGEPLERTAAYMVEALAARMATSGKGLYKALKCKEAL---FSERLSAMQVLFEVCPYFRFGFMA 297
                     79*****************************************************************8...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aIlea++ e+rvHiiDfdi+qG Q+ +Llq+Las p++pp+lR+Tgv++pes+      l+ +g rL+++A+ +++pfef++ va++++ ++
  XP_009766066.1 298 ANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLASMPGKPPHLRLTGVDDPESVqrAIGGLNVIGLRLEELAKDFKIPFEFQA-VASNTALVT 391
                     ******************************************************99777789***********************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     + +L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+r++e  +yysa+f+sl+a+l+r+s+er++v
  XP_009766066.1 392 PAMLNCHPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTTPFLQRVAEVYNYYSAVFESLDATLSRDSQERVNV 486
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     Er++l+r+i n+vaceg+er+er e ++kWr+r+++aGF+p p+s ++++++k l+++++++ y+ +ee g+l +gW+d++L+++SaW+
  XP_009766066.1 487 ERQCLARDIINIVACEGEERIERYEVAGKWRARMMMAGFTPSPISPNVYDSIKNLIKQYSER-YKAKEEAGALHFGWEDKSLIVASAWK 574
                     ************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.591178555IPR005202Transcription factor GRAS
PfamPF035141.7E-134206574IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MSLVRSVRTI GNGKLYFPND HKDNSGLSTS MFTKNAHGIM YATESSSTDS YDPKYLLDSP  60
SPSEELLNTS PSEELLNTSP SEVSGNPFHQ RHSSSFHPSR DYDACQLSYD CEDIVSQRPD  120
SLQYNDGRVT LKLQELERVL FDDNEVDGDD VFARGQCMDI DDEWFSQIGT VLLHDSPKES  180
TSADSNISSS SSYKEISVTA PQTPKQMLFS CAAAIQDGNI EQASSMINEL RQMVSIQGEP  240
LERTAAYMVE ALAARMATSG KGLYKALKCK EALFSERLSA MQVLFEVCPY FRFGFMAANG  300
AILEAFKDEK RVHIIDFDIN QGSQYYTLLQ TLASMPGKPP HLRLTGVDDP ESVQRAIGGL  360
NVIGLRLEEL AKDFKIPFEF QAVASNTALV TPAMLNCHPG EALIVNFAFQ LHHMPDESVS  420
TVNQRDQLLR MVKSLNPKLV TVVEQDMNTN TTPFLQRVAE VYNYYSAVFE SLDATLSRDS  480
QERVNVERQC LARDIINIVA CEGEERIERY EVAGKWRARM MMAGFTPSPI SPNVYDSIKN  540
LIKQYSERYK AKEEAGALHF GWEDKSLIVA SAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-582065746375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135910.0BT013591.1 Lycopersicon esculentum clone 132354R, mRNA sequence.
GenBankDQ3998280.0DQ399828.1 Lycopersicon esculentum GRAS6 (GRAS6) mRNA, complete cds.
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766061.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766062.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766064.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766065.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766066.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474681.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474687.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474696.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474704.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474710.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474713.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1